PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29929.m004627
Common NameRCOM_1079430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family SBP
Protein Properties Length: 404aa    MW: 44229.5 Da    PI: 8.5528
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29929.m004627genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.82.3e-4192168278
                    -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
            SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                    C v+gC++dls++++yhrrhkvCe hsk+p+v+++gleqrfCqqCsrfh+l efDe+krsCr+rL++hn+rrrk+q+
  29929.m004627  92 CLVDGCASDLSKCRDYHRRHKVCELHSKTPKVFIKGLEQRFCQQCSRFHSLVEFDEGKRSCRKRLDGHNRRRRKPQP 168
                    **************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.6E-3385153IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.15489166IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.45E-3990171IPR004333Transcription factor, SBP-box
PfamPF031105.6E-3092165IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MGYNLKTPWR LTELENQKIP RIAQTAVSNS SFTLNQVTGY CSVDLKLGNS GDLEDKLVEK  60
FSGPGDSLME SSSSGSSKRV RTPANGTHIP SCLVDGCASD LSKCRDYHRR HKVCELHSKT  120
PKVFIKGLEQ RFCQQCSRFH SLVEFDEGKR SCRKRLDGHN RRRRKPQPDS MPVNSARLFS  180
NHQELEAKKI RFQALLKCLC HIAGTRYLQF GGSQIFSTTG ASSGWAGAVK PENDPMLYTN  240
QSSLNFSSGK NLFPGSMSHS YRGGKQFPFS HCTSSTLPGE SVCQTILDVR STLGSSSGNQ  300
KMFSDGVNQV IDSNGALSLL SSPQAETREI GLSHMVQPDL NPPAQSLIPS LNFSNLGMEG  360
GPVESVLVSD GSHNGNLHSQ DMFQTGPDES SASGSHQRLS FSWE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-30921651184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1148165KRSCRKRLDGHNRRRRKP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015572162.10.0PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_015572163.10.0PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_015572164.10.0PREDICTED: squamosa promoter-binding-like protein 16
SwissprotQ6YZE81e-58SPL16_ORYSJ; Squamosa promoter-binding-like protein 16
TrEMBLB9RMC20.0B9RMC2_RICCO; Putative uncharacterized protein
STRINGPOPTR_0001s13630.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25913378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.13e-44SBP family protein